This week we’re talking about Gene, the son of Arlo and Janis, and the life he grew into somewhere on the coast. This series, from 10 years ago this month, is one of my favorites. Click on the date below the comic to see the entire two-week sequence on GoComics. I get criticism these days for not featuring Gene and Mary Lou and the low-country gang very often, and it is true I don’t. I will admit, those creative forays were fun and often produced good results. The foibles of Gene, et al, are very popular with certain of my readers. However, those readers are a subset, and evidence indicates more people want a daily dose of Arlo and Janis. And I suspect I have fallen into a familiar trap. Whether a writer or a singer or a cartoonist, every creative person who depends upon his or her craft for a living must walk a fine line between giving the people what they want and keeping material fresh. The problem is particularly acute in the age of “comments,” when voluminous and vociferous input from readers is available constantly. Actually, all my readers are important to me, and this so far is something of an excuse. More to the point, I began to get a little overwhelmed with the coastal cast. Big changes and important twists in their lives deserved much attention, and I didn’t feel as if I had the time to do them justice. As a result, nothing really seemed to happen. I did step away, but this is all on me, really. It’s my job as the cartoonist to solve this sort of problem, and I have been negligent. However, all this talk recently has gotten my juices flowing a bit. To be continued…
Water, Water Everywhere
By Jimmy Johnson
Recent Posts
Ghost of Christmas Past
This holiday Arlo & Janis comic strip from 2022 is similar in concept to the new strip that ran yesterday. I thought the latter ...
Spearhead
I have produced a number of comic strips related to Veteran’s Day. Especially in latter years, I have tried to emphasize the universal experience ...
Dark Passage
Remember: it’s that weekend. The return to standard time can be a bit of a shock in the late afternoon, but I rather enjoy ...
What’s old is old, again
You don’t have to be a rocket scientist to build a web site, but there are similarities. Everything needs to be just right, or ...
Back to the ol’ drawing board
I don’t have a lot of time this morning. I wasn’t going to post anything, but I’m tired of looking at that old photograph ...
Thursday’s Child
On Sunday, I teased you with the suggestion there are more changes coming here. There are. They will appear soon, and I think you’ll ...
72 responses to “Water, Water Everywhere”
Whoa! This blog looks exactly like my old one! It’s on a entirely different topic but it has pretty much the same
layout and design. Outstanding choice of colors!
I am in fact grateful to the holder of this website who has shared this
enormous paragraph at at this time. asmr https://app.gumroad.com/asmr2021/p/best-asmr-online asmr
Hi there, I discovered your web site by the use of Google while looking for a related
matter, your web site came up, it seems to be good.
I’ve bookmarked it in my google bookmarks.
Hi there, simply was alert to your weblog through Google,
and located that it is truly informative. I’m going to be careful for
brussels. I’ll be grateful in case you proceed this in future.
Lots of other folks will probably be benefited out of your
writing. Cheers! quest bars http://j.mp/3C2tkMR quest bars
I am not sure where you’re getting your info, but good topic.
I needs to spend some time learning more or understanding
more. Thanks for excellent information I was looking
for this info for my mission. scoliosis surgery https://0401mm.tumblr.com/ scoliosis
surgery
Hiya, I’m really glad I have found this information.
Nowadays bloggers publish only about gossips and net and this is actually irritating.
A good website with exciting content, that is what I need.
Thanks for keeping this web-site, I will be visiting it. Do you do newsletters?
Can’t find it.
my blog; Evergold Farms CBD
I was able to find good advice from your content.
My web blog: Level Goods CBD Gummies
This web site is my inspiration, real good design and Perfect content material.
My blog post Keto Speed Diet
You completed some good points there. I did a search on the matter and found
the majority of persons will go along with with your blog.
my web page: Cut Slim Keto Reviews
I know this if off topic but I’m looking into starting my own weblog and was curious what all is required to
get setup? I’m assuming having a blog like yours would cost a pretty penny?
I’m not very web smart so I’m not 100% positive. Any recommendations or advice would be greatly
appreciated. Appreciate it cheap flights http://1704milesapart.tumblr.com/ cheap
flights
I have read so many posts concerning the blogger lovers however this paragraph is actually a fastidious piece of writing, keep it up.
quest bars https://www.iherb.com/search?kw=quest%20bars quest bars
What i do not realize is in truth how you are no longer actually a
lot more smartly-appreciated than you may be right now.
You’re very intelligent. You recognize therefore considerably in terms of this subject,
made me individually believe it from so many various angles.
Its like women and men are not interested except it is one
thing to accomplish with Girl gaga! Your own stuffs nice.
Always take care of it up! scoliosis surgery https://coub.com/stories/962966-scoliosis-surgery scoliosis surgery
I am extremely impressed with your writing skills and also with the layout on your weblog.
Is this a paid theme or did you customize it yourself?
Either way keep up the nice quality writing, it’s rare to see a nice blog like
this one these days. ps4 games https://bit.ly/3z5HwTp ps4
Hey there! Quick question that’s totally off topic. Do you know how to make your site mobile friendly?
My website looks weird when viewing from my iphone 4.
I’m trying to find a theme or plugin that might
be able to resolve this problem. If you have any suggestions, please
share. Thank you!
My web blog :: http://elitmaster1.ru/
It’s not my first time to visit this web page, i am visiting this web page dailly and obtain nice information from here everyday.
Take a look at my blog post – ravenhawksmagickalmysticalplaces.com