This week we’re talking about Gene, the son of Arlo and Janis, and the life he grew into somewhere on the coast. This series, from 10 years ago this month, is one of my favorites. Click on the date below the comic to see the entire two-week sequence on GoComics. I get criticism these days for not featuring Gene and Mary Lou and the low-country gang very often, and it is true I don’t. I will admit, those creative forays were fun and often produced good results. The foibles of Gene, et al, are very popular with certain of my readers. However, those readers are a subset, and evidence indicates more people want a daily dose of Arlo and Janis. And I suspect I have fallen into a familiar trap. Whether a writer or a singer or a cartoonist, every creative person who depends upon his or her craft for a living must walk a fine line between giving the people what they want and keeping material fresh. The problem is particularly acute in the age of “comments,” when voluminous and vociferous input from readers is available constantly. Actually, all my readers are important to me, and this so far is something of an excuse. More to the point, I began to get a little overwhelmed with the coastal cast. Big changes and important twists in their lives deserved much attention, and I didn’t feel as if I had the time to do them justice. As a result, nothing really seemed to happen. I did step away, but this is all on me, really. It’s my job as the cartoonist to solve this sort of problem, and I have been negligent. However, all this talk recently has gotten my juices flowing a bit. To be continued…
Water, Water Everywhere

72 responses to “Water, Water Everywhere”
Good am JJ: Like this theme. I hope we don’t send criticism. Always well done. Just suggestions.
The good news is, the comments both here and on the FB site never veer into ‘vociferous’; rather, they’re uniformly supportive (says the guy who wore his A&J tee to the beach last week). Gene and Mary Lou do deserve more ‘air time’, either here or in print. JJ has managed to work ‘reality’ (i.e., Covid-19) into his strips while most of his peers avoid the topic. Gene, Mary Lou an Meg would, on the other hand, should be going through an existential crisis… out of which should come opportunity through creativity (supplied, I’ll bet, by Meg). A&J has always been about ‘real life’ first and humor second. There is a story to be told; JJ ought to tell it with his special combination of empathy and sharp eyes.
Sometimes we fans forget that JJ isn’t really peeking into our windows, or his characters’ windows, and just documenting what he sees. There’s a LOT more effort involved, especially with story arcs. That’s why we mere mortals can’t do what he does.
Gene and his family are fresh breezes from the coast.They remind me of nieces and nephews who- if I’m lucky- come to visit for a while and then go back to their own busy lives. And forget to write. 🙂
Maybe it’s time for a spinoff strip! OK, not really.
This strip reminds me that I heard one of my nieces earnestly explain to my sister-in-law “When Uncle Craig says he needs to powder his nose he means he has to tinkle”.
Llee may have provided a solution. In all the years, Gene, MaryLou and Shrimp have never visited Arlo & Janis. It’s always the other way around. And maybe during COVID, it would be understandable if Gene’s family needed to pull up stakes and join his parents for awhile. Just saying, it would be a way to include all the characters on A&J home turf – temporarily. Think of all the disruption! But, it’s just an idea. Yeah, JJ’s gotta do what he’s gotta do. And we’re ok with that.
Yes, it would be fun to see how Shrimp and Ludwig would interact, too.
Unwise, from a covid-19 standpoint. A&J are a “unit” and G&ML&Shrimp are a different “unit”.
My thought exactly.
Eh, he’ll do what he wants, and that’s fine, but if they really had to pull up stakes and closed the business (temporarily or not) and they just hung out for 2 weeks not interacting with customers or most anyone else, and took precautions for shopping and such, they’d be fine to come if they had no symptoms showing after that time. Arlo has more risk on his shopping runs than them visiting if they isolated for a little while.
Thanks so much for posting this and the link to continue. I had totally forgotten about this and loved reading it! 🙂
Remember: the sequence goes on two weeks. There’s a Sunday strip in the middle.
I love whatever you write/draw! You are a genius!
I do miss Gene, ML, “Shrimp”, and Gus. But not as much as I’d miss Arlo and Janis. (Witness recent “retirement” commotion.) So keep on keepin’ on as you see fit, Jimmy.
Heh. It’s more a problem of having too many interesting characters that people care about and not keeping them together in the same place. This is probably why many comics freeze their child characters in time rather than letting them grow up and leave home.
What Ray said- so many interesting characters that people can relate to. And if Ruth ever makes an appearance at Gene and Mary Lou’s diner- oh man.
When we look back on the decline of civilization, Internet comments will probably come in #2 behind Twitter as the cause.
Thank you for your comment.
🙂
When Walt Disney finished “Snow White and the Seven Dwarfs,” the public clamored for more—“dwarfs.” W. D. couldn’t understand it: They had done was all there was to the Snow White story, so how could they do any more? So he moved on to “Pinocchio” et cetera. But the public didn’t think as well anymore in terms of story and culture, but in simply seeing favorite characters. Rather than fairy tales developing by *everyone*, the “folk,” telling them themselves and making up new ones—and telling what they themselves wanted to hear, more about dwarfs, for instance—the public had lately come to expect to have professionals “entertain” them, and the public was indeed forgetting how good stories are done. Now, I admire an excellent professional (and I have striven to be one), and that’s why I’m here. And I defer (I think we all here do) to the professional, Mister J. J., whose choices I find to be consistently excellent, in the category of, say, Percy Crosby, and, oh, Marty Links–the drawing of those two!
To me, the magic of A&J is that it has mirrored the various stages of adult life for those of us who are children of the 50’s and 60’s. Perhaps an annual visit to the Day’s at the shore would be in order.
Fans need to remember we are given the privilege of sharing what the artist/author creates. We are visitors to a world that can abruptly end, frozen in time, for many reasons.
Two of my favorite strips ended like that, literally to sudden death. Others died suddenly to burn out, while others to long time repetitions of the same jokes.
We own no part of a creative process that is not our own. Ironically I asked Ghost on Monday why John Lennon was murdered? Why would anyone hate him and his music?
Ghost answered that the killer loved his music and had been a fan? A fan who thought he was due something more? He wanted Lennon to be what he wanted him to be.
We are due nothing more than we are given.
Jackie-
Right on target. Rather than expecting (demanding) artists to create more of the same to entertain us, we need to appreciate the art they have shared with us.
Could you imagine Shakespeare or Michelangelo in today’s internet-driven, immediate gratification environment? “The Sistine Chapel was OK, but now I want to see him do Greek mythology.”
“I wonder if she’d marry me?”
No prescience?
“I did step away, but this is all on me, really. It’s my job as the cartoonist to solve this sort of problem, and I have been negligent. However, all this talk recently has gotten my juices flowing a bit. To be continued…” Oh ow! You’re going to draw out the tension on this aren’t you, you sneaky writer, you! LOL I’ll have you know you had me checking here before I even had my first cup of morning tea today, just to reassure myself that “the kids” (who remind me so much of my adult son and his wife) are still ok in the pandemic and economic storms and hurricanes and . . . hoo boy. All of it. I just want them to be ok.
Gross comic for the day.
https://www.gocomics.com/humble-stumble/2020/08/13
Peace,
Thanks for that link to the Meg/Gene series. I remember it, and I still had the “onion” issue on several of them.
Finally got my federal tax refund – 5 months after mailing it in. It was for almost $25 more than I had asked. I suppose the difference is interest on the amount. Hope the IRS tells me about it so I can file that tidbit for next spring’s returns.
emb: I have read that strip from its inception to its end, almost twice. I do not remember that particular gustatory delight. Just as well….
Its like you learn my mind! You seem to grasp so much approximately
this, like you wrote the e book in it or something. I think that you just could do with a few p.c.
to force the message house a little bit, however instead of that, this is fantastic blog.
An excellent read. I’ll certainly be back.
What i don’t realize is in truth how you are no longer really a lot more smartly-favored than you may be right now.
You’re very intelligent. You recognize therefore considerably in the case of this topic, produced me personally consider it from numerous varied angles. Its like women and men are not involved unless it’s something to do with Woman gaga! Your individual stuffs great.
At all times handle it up!
I have been exploring for a little bit for any high-quality articles
or blog posts on this sort of house . Exploring in Yahoo I finally
stumbled upon this site. Studying this information So i’m satisfied to convey that I’ve an incredibly excellent uncanny feeling I discovered just what
I needed. I such a lot no doubt will make sure to do not forget this
web site and give it a look on a relentless basis.
Also visit my website: Ultra Cut Keto Review
Excellent, what a website it is! This blog provides useful information to us, keep it
up.
fantastic post, very informative. I’m wondering why the other specialists of
this sector do not realize this. You should proceed your writing.
I’m sure, you’ve a great readers’ base already!
Awesome blog! Is your theme custom made or did you download it from
somewhere? A theme like yours with a few simple adjustements would
really make my blog jump out. Please let me know where
you got your theme. Kudos
Here is my web blog :: FrioBreeze (http://www.wizardhardware.com)
Hi, i think that i saw you visited my blog so i got here to go back the want?.I’m attempting to find things to enhance my site!I assume its good enough to make use of a
few of your ideas!!
This site was… how do I say it? Relevant!! Finally I have found something
which helped me. Thanks a lot!
Feel free to surf to my web site … Ashley
I’m really enjoying the design and layout of
your site. It’s a very easy on the eyes which makes it much more enjoyable for me to come here and visit more often. Did
you hire out a developer to create your theme? Great work!
I simply wanted to thank you a lot more for
your amazing web page you have designed
here. Its full of ideas for those who are truly interested in this kind of subject, specifically this very post.
You’re really all so sweet as well as thoughtful of others as well as reading
your blog posts is a great delight in my opinion. And what generous present!
Dan and I will have enjoyment making use of your points in what we must
do in a few days. Our collection of ideas is a
distance long which means that your tips are going to be put to beneficial use.
my page: Coastal Hemp CBD (http://www.wizardhardware.com)
I think this is one of the so much significant info for me.
And i’m glad studying your article. But wanna remark on some common issues, The
web site taste is perfect, the articles is in point of fact excellent
: D. Good process, cheers
My website Compoise CBD
Very energetic article, I loved that bit. Will there be a part 2?
Stop by my web site 360X CBD Gummies
Hey there just wanted to give you a brief heads up and let you know a few
of the images aren’t loading correctly. I’m not sure
why but I think its a linking issue. I’ve tried it in two different web browsers and both show the same results.
Hi, yeah this post is in fact pleasant and I have learned
lot of things from it regarding blogging. thanks.
Review my page; Frio Breeze Reviews
Hey there just wanted to give you a quick heads up. The
words in your article seem to be running off the screen in Chrome.
I’m not sure if this is a format issue or something to
do with internet browser compatibility but I thought I’d post to let
you know. The style and design look great though!
Hope you get the problem fixed soon. Cheers
I have been exploring for a little bit for any high-quality articles or weblog posts in this kind of area
. Exploring in Yahoo I finally stumbled upon this web site.
Studying this info So i am glad to show that I’ve an incredibly excellent uncanny feeling I discovered exactly what I needed.
I most surely will make certain to do not overlook this web site and give it a glance
regularly.
Also visit my web site; Compoise 360X CBD Review
I conceive this internet site has very great composed written content content.
Also visit my webpage; Flow Zone Pills
Hi, i think that i noticed you visited my website thus i came to return the favor?.I am trying to find things to improve my site!I guess its adequate
to use a few of your ideas!!
my blog post; Pure Remedy CBD Oil Review
But wanna remark on few general things, The website
layout is perfect, the content material is real excellent :D.
Also visit my web-site :: 360X CBD
Super article it is definitely. I’ve been awaiting for this info.
My site – http://www.comptine.biz
Rattling informative and wonderful anatomical
structure of written content, now that’s user pleasant (:.
Take a look at my webpage :: Bio Keto
Good blog you have got here.. It?s difficult to find high-quality writing like yours
nowadays. I truly appreciate people like you! Take care!!
My web-site Advanced CBD Oil Review
Some genuinely good posts on this site, regards for contribution.
My homepage: Yec Keto Reviews
It’s not my first time to pay a visit this site, i am visiting
this web page dailly and get fastidious facts from here everyday.
I don’t even know how I ended up here, but I thought this post was
good. I do not know who you are but definitely you’re going to a famous blogger if you aren’t already 😉 Cheers!
Wow, superb blog layout! How long have you been blogging for?
you made blogging look easy. The overall look of your web site is wonderful, let alone
the content!
I’ve learn several just right stuff here. Certainly price bookmarking for
revisiting. I wonder how so much effort you set to create this kind of
great informative website.
Hey I know this is off topic but I was wondering if you knew of any widgets I could add to my
blog that automatically tweet my newest twitter updates.
I’ve been looking for a plug-in like this for quite some time and was
hoping maybe you would have some experience with something like this.
Please let me know if you run into anything. I truly enjoy reading your blog
and I look forward to your new updates.
Hurrah! In the end I got a blog from where I be capable of truly get useful facts concerning
my study and knowledge.
my web-site :: Hedofirm Male Enhancement Reviews
I’m very happy to find this great site. I need to
to thank you for your time for this fantastic read!!
I definitely loved every part of it and I have you bookmarked to look at new things on your blog.
Whoa! This blog looks exactly like my old one! It’s on a entirely different topic but it has pretty much the same
layout and design. Outstanding choice of colors!
I am in fact grateful to the holder of this website who has shared this
enormous paragraph at at this time. asmr https://app.gumroad.com/asmr2021/p/best-asmr-online asmr
Hi there, I discovered your web site by the use of Google while looking for a related
matter, your web site came up, it seems to be good.
I’ve bookmarked it in my google bookmarks.
Hi there, simply was alert to your weblog through Google,
and located that it is truly informative. I’m going to be careful for
brussels. I’ll be grateful in case you proceed this in future.
Lots of other folks will probably be benefited out of your
writing. Cheers! quest bars http://j.mp/3C2tkMR quest bars
I am not sure where you’re getting your info, but good topic.
I needs to spend some time learning more or understanding
more. Thanks for excellent information I was looking
for this info for my mission. scoliosis surgery https://0401mm.tumblr.com/ scoliosis
surgery
Hiya, I’m really glad I have found this information.
Nowadays bloggers publish only about gossips and net and this is actually irritating.
A good website with exciting content, that is what I need.
Thanks for keeping this web-site, I will be visiting it. Do you do newsletters?
Can’t find it.
my blog; Evergold Farms CBD
I was able to find good advice from your content.
My web blog: Level Goods CBD Gummies
This web site is my inspiration, real good design and Perfect content material.
My blog post Keto Speed Diet
You completed some good points there. I did a search on the matter and found
the majority of persons will go along with with your blog.
my web page: Cut Slim Keto Reviews
I know this if off topic but I’m looking into starting my own weblog and was curious what all is required to
get setup? I’m assuming having a blog like yours would cost a pretty penny?
I’m not very web smart so I’m not 100% positive. Any recommendations or advice would be greatly
appreciated. Appreciate it cheap flights http://1704milesapart.tumblr.com/ cheap
flights
I have read so many posts concerning the blogger lovers however this paragraph is actually a fastidious piece of writing, keep it up.
quest bars https://www.iherb.com/search?kw=quest%20bars quest bars
What i do not realize is in truth how you are no longer actually a
lot more smartly-appreciated than you may be right now.
You’re very intelligent. You recognize therefore considerably in terms of this subject,
made me individually believe it from so many various angles.
Its like women and men are not interested except it is one
thing to accomplish with Girl gaga! Your own stuffs nice.
Always take care of it up! scoliosis surgery https://coub.com/stories/962966-scoliosis-surgery scoliosis surgery
I am extremely impressed with your writing skills and also with the layout on your weblog.
Is this a paid theme or did you customize it yourself?
Either way keep up the nice quality writing, it’s rare to see a nice blog like
this one these days. ps4 games https://bit.ly/3z5HwTp ps4
Hey there! Quick question that’s totally off topic. Do you know how to make your site mobile friendly?
My website looks weird when viewing from my iphone 4.
I’m trying to find a theme or plugin that might
be able to resolve this problem. If you have any suggestions, please
share. Thank you!
My web blog :: http://elitmaster1.ru/
It’s not my first time to visit this web page, i am visiting this web page dailly and obtain nice information from here everyday.
Take a look at my blog post – ravenhawksmagickalmysticalplaces.com